Lineage for d3slec_ (3sle C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964111Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1964112Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1964113Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1964136Protein automated matches [190303] (3 species)
    not a true protein
  7. 1964169Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1964206Domain d3slec_: 3sle C: [192076]
    automated match to d2bbkl_
    complexed with act, ca, edo, hec

Details for d3slec_

PDB Entry: 3sle (more details), 2.52 Å

PDB Description: Crystal Structure of the P107C-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3slec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slec_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkashhhh

SCOPe Domain Coordinates for d3slec_:

Click to download the PDB-style file with coordinates for d3slec_.
(The format of our PDB-style files is described here.)

Timeline for d3slec_: