Class g: Small proteins [56992] (90 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
Protein automated matches [190303] (2 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries) |
Domain d3sjle_: 3sjl E: [192075] Other proteins in same PDB: d3sjld_, d3sjlf_ automated match to d2bbkl_ complexed with ca, edo, hec, mes, na, peg |
PDB Entry: 3sjl (more details), 1.63 Å
SCOPe Domain Sequences for d3sjle_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sjle_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d3sjle_: