SCOPe 2.02: Domain d1elwa_: 1elw A:

Lineage for d1elwa_ (1elw A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Hop [48456] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48457] (3 PDB entries)

8. Domain d1elwa_: 1elw A: [19207]
   TPR1-domain
   complexed with ni, trs

Details for d1elwa_

PDB Entry: 1elw, 1.6 Å

PDB Description: Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide

PDB Compounds: (A:) tpr1-domain of hop

SCOPe Domain Sequences for d1elwa_:

Sequence; same for both SEQRES and ATOM records:

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}
eqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayedg
cktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmear

Timeline for d1elwa_:

• d1elwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1elwa_ appears in SCOPe 2.01
  
• d1elwa_ appears in SCOPe 2.03
  
• d1elwa_ appears in the current release, SCOPe 2.08