Lineage for d3sdir_ (3sdi R:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439383Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (16 PDB entries)
  8. 1439397Domain d3sdir_: 3sdi R: [192065]
    Other proteins in same PDB: d3sdi1_, d3sdi2_, d3sdia_, d3sdic_, d3sdie_, d3sdig_, d3sdih_, d3sdii_, d3sdij_, d3sdik_, d3sdil_, d3sdim_, d3sdin_, d3sdio_, d3sdiq_, d3sdis_, d3sdiu_, d3sdiv_, d3sdiw_, d3sdix_, d3sdiy_, d3sdiz_
    automated match to d1jd2y_
    complexed with 3sd, mes, mg

Details for d3sdir_

PDB Entry: 3sdi (more details), 2.65 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 20
PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d3sdir_:

Sequence, based on SEQRES records: (download)

>d3sdir_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiveid
rhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegasgee
rlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssl
tlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

Sequence, based on observed residues (ATOM records): (download)

>d3sdir_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
vstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiveid
rhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfmsrpfgva
lliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlkeaellvl
kilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d3sdir_:

Click to download the PDB-style file with coordinates for d3sdir_.
(The format of our PDB-style files is described here.)

Timeline for d3sdir_: