SCOPe 2.01: Domain d1a17a_: 1a17 A:

Lineage for d1a17a_ (1a17 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Protein phosphatase 5 [48454] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries)

8. Domain d1a17a_: 1a17 A: [19206]
   complexed with so4

Details for d1a17a_

PDB Entry: 1a17, 2.45 Å

PDB Description: tetratricopeptide repeats of protein phosphatase 5

PDB Compounds: (A:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1a17a_:

Sequence; same for both SEQRES and ATOM records:

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}
ppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecy
gyalgdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqe
cnkivkqkaferaiagdehkrsvvdsldiesmtiedeys

Timeline for d1a17a_:

• d1a17a_ first appeared (with stable ids) in SCOP 1.55, called d1a17__
  
• d1a17a_ appears in SCOP 1.75
  
• d1a17a_ appears in SCOPe 2.02
  
• d1a17a_ appears in the current release, SCOPe 2.08