![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (2 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (13 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Protein phosphatase 5 [48454] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48455] (1 PDB entry) |
![]() | Domain d1a17__: 1a17 - [19206] complexed with so4 |
PDB Entry: 1a17 (more details), 2.45 Å
SCOP Domain Sequences for d1a17__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a17__ a.118.8.1 (-) Protein phosphatase 5 {Human (Homo sapiens)} ppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecy gyalgdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqe cnkivkqkaferaiagdehkrsvvdsldiesmtiedeys
Timeline for d1a17__: