SCOP 1.57: Domain d1a17__: 1a17 -

Lineage for d1a17__ (1a17 -)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (6 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Protein phosphatase 5 [48454] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48455] (1 PDB entry)

8. Domain d1a17__: 1a17 - [19206]

Details for d1a17__

PDB Entry: 1a17, 2.45 Å

PDB Description: tetratricopeptide repeats of protein phosphatase 5

SCOP Domain Sequences for d1a17__:

Sequence; same for both SEQRES and ATOM records:

>d1a17__ a.118.8.1 (-) Protein phosphatase 5 {Human (Homo sapiens)}
ppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecy
gyalgdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqe
cnkivkqkaferaiagdehkrsvvdsldiesmtiedeys

Timeline for d1a17__:

• d1a17__ first appeared (with stable ids) in SCOP 1.55
  
• d1a17__ appears in SCOP 1.59
  
• d1a17__ appears in the current release, SCOPe 2.08, called d1a17a_