Lineage for d3saca_ (3sac A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799193Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)
  8. 2799225Domain d3saca_: 3sac A: [192056]
    automated match to d2f3ka_
    complexed with af8, po4

Details for d3saca_

PDB Entry: 3sac (more details), 1.5 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with af80
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3saca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3saca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3saca_:

Click to download the PDB-style file with coordinates for d3saca_.
(The format of our PDB-style files is described here.)

Timeline for d3saca_: