Lineage for d3saba_ (3sab A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408719Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)
  8. 2408753Domain d3saba_: 3sab A: [192054]
    automated match to d2f3ka_
    complexed with f78, po4

Details for d3saba_

PDB Entry: 3sab (more details), 1.5 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with af78
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3saba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3saba_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3saba_:

Click to download the PDB-style file with coordinates for d3saba_.
(The format of our PDB-style files is described here.)

Timeline for d3saba_: