Lineage for d1qjab_ (1qja B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50682Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 50683Family a.118.7.1: 14-3-3 protein [48446] (2 proteins)
  6. 50687Protein zeta isoform [48449] (2 species)
  7. 50697Species Human (Homo sapiens) [TaxId:9606] [48451] (3 PDB entries)
  8. 50701Domain d1qjab_: 1qja B: [19205]

Details for d1qjab_

PDB Entry: 1qja (more details), 2 Å

PDB Description: 14-3-3 zeta/phosphopeptide complex (mode 2)

SCOP Domain Sequences for d1qjab_:

Sequence, based on SEQRES records: (download)

>d1qjab_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens)}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d1qjab_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens)}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevakkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilns
pekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt

SCOP Domain Coordinates for d1qjab_:

Click to download the PDB-style file with coordinates for d1qjab_.
(The format of our PDB-style files is described here.)

Timeline for d1qjab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qjaa_