Lineage for d3sa7b_ (3sa7 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067690Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (50 PDB entries)
  8. 2067711Domain d3sa7b_: 3sa7 B: [192047]
    automated match to d2f3ka_
    complexed with 55a, po4

Details for d3sa7b_

PDB Entry: 3sa7 (more details), 1.5 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with af55
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3sa7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sa7b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3sa7b_:

Click to download the PDB-style file with coordinates for d3sa7b_.
(The format of our PDB-style files is described here.)

Timeline for d3sa7b_: