![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (48 PDB entries) |
![]() | Domain d3sa6b_: 3sa6 B: [192045] automated match to d2f3ka_ complexed with f71, po4 |
PDB Entry: 3sa6 (more details), 1.75 Å
SCOPe Domain Sequences for d3sa6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sa6b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3sa6b_: