SCOPe 2.02: Domain d3sa5a_: 3sa5 A:

Lineage for d3sa5a_ (3sa5 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (38 PDB entries)

8. Domain d3sa5a_: 3sa5 A: [192042]
   automated match to d2f3ka_
   complexed with a69, act, po4

Details for d3sa5a_

PDB Entry: 3sa5, 1.65 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with af69

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3sa5a_:

Sequence; same for both SEQRES and ATOM records:

>d3sa5a_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3sa5a_:

• d3sa5a_ is new in SCOPe 2.02-stable
  
• d3sa5a_ appears in SCOPe 2.03
  
• d3sa5a_ appears in the current release, SCOPe 2.08