Lineage for d1qjbb_ (1qjb B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100737Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 100738Family a.118.7.1: 14-3-3 protein [48446] (2 proteins)
  6. 100742Protein zeta isoform [48449] (2 species)
  7. 100752Species Human (Homo sapiens) [TaxId:9606] [48451] (3 PDB entries)
  8. 100754Domain d1qjbb_: 1qjb B: [19203]

Details for d1qjbb_

PDB Entry: 1qjb (more details), 2 Å

PDB Description: 14-3-3 zeta/phosphopeptide complex (mode 1)

SCOP Domain Sequences for d1qjbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjbb_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens)}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdt

SCOP Domain Coordinates for d1qjbb_:

Click to download the PDB-style file with coordinates for d1qjbb_.
(The format of our PDB-style files is described here.)

Timeline for d1qjbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qjba_