Lineage for d1qjbb_ (1qjb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726478Protein zeta isoform [48449] (2 species)
  7. 2726488Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries)
  8. 2726494Domain d1qjbb_: 1qjb B: [19203]
    phosphopeptide complex

Details for d1qjbb_

PDB Entry: 1qjb (more details), 2 Å

PDB Description: 14-3-3 zeta/phosphopeptide complex (mode 1)
PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d1qjbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjbb_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdt

SCOPe Domain Coordinates for d1qjbb_:

Click to download the PDB-style file with coordinates for d1qjbb_.
(The format of our PDB-style files is described here.)

Timeline for d1qjbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qjba_