Lineage for d3s85j_ (3s85 J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2408657Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2408673Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2408922Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2410038Domain d3s85j_: 3s85 J: [192027]
    automated match to d1izha_
    complexed with lk0

Details for d3s85j_

PDB Entry: 3s85 (more details), 2.8 Å

PDB Description: Discovery of New HIV Protease Inhibitors with Potential for Convenient Dosing and Reduced Side Effects: A-790742 and A-792611.
PDB Compounds: (J:) Protease/Reverse transcriptase

SCOPe Domain Sequences for d3s85j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s85j_ b.50.1.1 (J:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3s85j_:

Click to download the PDB-style file with coordinates for d3s85j_.
(The format of our PDB-style files is described here.)

Timeline for d3s85j_: