Class b: All beta proteins [48724] (178 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (578 PDB entries) Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167 |
Domain d3s85c_: 3s85 C: [192020] automated match to d1izha_ complexed with lk0 |
PDB Entry: 3s85 (more details), 2.8 Å
SCOPe Domain Sequences for d3s85c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s85c_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3s85c_: