Lineage for d3rs6a_ (3rs6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042875Species Dioclea virgata [TaxId:167618] [189798] (2 PDB entries)
  8. 2042876Domain d3rs6a_: 3rs6 A: [191982]
    automated match to d3rrda_
    complexed with ca, mn, xmm

Details for d3rs6a_

PDB Entry: 3rs6 (more details), 1.8 Å

PDB Description: Crystal structure Dioclea virgata lectin in complexed with X-mannose
PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d3rs6a_:

Sequence, based on SEQRES records: (download)

>d3rs6a_ b.29.1.1 (A:) automated matches {Dioclea virgata [TaxId: 167618]}
adtivaveldsypntdigdpsyphigidiksvrskstarwnmqtgkvgtahisynsvakr
lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfnqfsqnpkdlilqgdattdsdgnlqltrvssdgspqgssvgralfyapvh
iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d3rs6a_ b.29.1.1 (A:) automated matches {Dioclea virgata [TaxId: 167618]}
adtivaveldsypntdigdpsyphigidiksvrskstarwnmqtgkvgtahisynsvakr
lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktans
lhfsfnqfsqnpkdlilqgdattdsdgnlqltrvssdgspqgssvgralfyapvhiweks
avvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d3rs6a_:

Click to download the PDB-style file with coordinates for d3rs6a_.
(The format of our PDB-style files is described here.)

Timeline for d3rs6a_: