SCOPe 2.07: Domain d3rn1c1: 3rn1 C:7-131

Lineage for d3rn1c1 (3rn1 C:7-131)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (3 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)

8. Domain d3rn1c1: 3rn1 C:7-131 [191980]
   Other proteins in same PDB: d3rn1c2, d3rn1d_, d3rn1f_
   automated match to d2bbkl_
   complexed with 1pe, act, ca, edo, hec, na, pg4

Details for d3rn1c1

PDB Entry: 3rn1, 1.93 Å

PDB Description: Crystal Structure of the W199E-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3rn1c1:

Sequence; same for both SEQRES and ATOM records:

>d3rn1c1 g.21.1.1 (C:7-131) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d3rn1c1:

• d3rn1c1 first appeared in SCOPe 2.02, called d3rn1c_
  
• d3rn1c1 appears in SCOPe 2.06
  
• d3rn1c1 appears in the current release, SCOPe 2.08