![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
![]() | Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) ![]() |
![]() | Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins) automatically mapped to Pfam PF02975 |
![]() | Protein automated matches [190303] (3 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries) |
![]() | Domain d3rn1c1: 3rn1 C:7-131 [191980] Other proteins in same PDB: d3rn1c2, d3rn1d_, d3rn1f_ automated match to d2bbkl_ complexed with 1pe, act, ca, edo, hec, na, pg4 |
PDB Entry: 3rn1 (more details), 1.93 Å
SCOPe Domain Sequences for d3rn1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rn1c1 g.21.1.1 (C:7-131) automated matches {Paracoccus denitrificans [TaxId: 318586]} tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi vgkas
Timeline for d3rn1c1: