SCOPe 2.05: Domain d3r6ec_: 3r6e C:

Lineage for d3r6ec_ (3r6e C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
   barrel, closed; n=5, S=8

6. Protein automated matches [191079] (2 species)
   not a true protein

7. Species Thermococcus thioreducens [TaxId:277988] [189009] (9 PDB entries)

8. Domain d3r6ec_: 3r6e C: [191971]
   automated match to d3q5va_
   complexed with nh4, so4

Details for d3r6ec_

PDB Entry: 3r6e, 1.18 Å

PDB Description: the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate

PDB Compounds: (C:) Tt-IPPase

SCOPe Domain Sequences for d3r6ec_:

Sequence; same for both SEQRES and ATOM records:

>d3r6ec_ b.40.5.1 (C:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

Timeline for d3r6ec_:

• d3r6ec_ first appeared in SCOPe 2.02
  
• d3r6ec_ appears in SCOPe 2.04
  
• d3r6ec_ appears in SCOPe 2.06
  
• d3r6ec_ appears in the current release, SCOPe 2.08