Lineage for d3r6eb_ (3r6e B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384030Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2384138Protein automated matches [191079] (3 species)
    not a true protein
  7. 2384151Species Thermococcus thioreducens [TaxId:277988] [189009] (8 PDB entries)
  8. 2384156Domain d3r6eb_: 3r6e B: [191970]
    automated match to d3q5va_
    complexed with nh4, so4

Details for d3r6eb_

PDB Entry: 3r6e (more details), 1.18 Å

PDB Description: the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate
PDB Compounds: (B:) Tt-IPPase

SCOPe Domain Sequences for d3r6eb_:

Sequence, based on SEQRES records: (download)

>d3r6eb_ b.40.5.1 (B:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

Sequence, based on observed residues (ATOM records): (download)

>d3r6eb_ b.40.5.1 (B:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedkdwkvlavpvedpyfndwkdis
dvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

SCOPe Domain Coordinates for d3r6eb_:

Click to download the PDB-style file with coordinates for d3r6eb_.
(The format of our PDB-style files is described here.)

Timeline for d3r6eb_: