SCOPe 2.05: Domain d3r0wb_: 3r0w B:

Lineage for d3r0wb_ (3r0w B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3r0wb_: 3r0w B: [191956]
   automated match to d3ou1a_
   complexed with rsy

Details for d3r0wb_

PDB Entry: 3r0w, 1.7 Å

PDB Description: Crystal Structures of Multidrug-resistant HIV-1 Protease in Complex with Mechanism-Based Aspartyl Protease Inhibitors.

PDB Compounds: (B:) Multidrug-resistant clinical isolate 769 HIV-1 Protease

SCOPe Domain Sequences for d3r0wb_:

Sequence; same for both SEQRES and ATOM records:

>d3r0wb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf

Timeline for d3r0wb_:

• d3r0wb_ first appeared in SCOPe 2.02
  
• d3r0wb_ appears in SCOPe 2.04
  
• d3r0wb_ appears in SCOPe 2.06
  
• d3r0wb_ appears in the current release, SCOPe 2.08