SCOPe 2.02: Domain d3r0wa_: 3r0w A:

Lineage for d3r0wa_ (3r0w A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (7 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (413 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3r0wa_: 3r0w A: [191955]
   automated match to d3ou1a_
   complexed with rsy

Details for d3r0wa_

PDB Entry: 3r0w, 1.7 Å

PDB Description: Crystal Structures of Multidrug-resistant HIV-1 Protease in Complex with Mechanism-Based Aspartyl Protease Inhibitors.

PDB Compounds: (A:) Multidrug-resistant clinical isolate 769 HIV-1 Protease

SCOPe Domain Sequences for d3r0wa_:

Sequence; same for both SEQRES and ATOM records:

>d3r0wa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf

Timeline for d3r0wa_:

• d3r0wa_ is new in SCOPe 2.02-stable
  
• d3r0wa_ appears in SCOPe 2.03
  
• d3r0wa_ appears in the current release, SCOPe 2.08