Lineage for d3qt0a_ (3qt0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (111 PDB entries)
    Uniprot P37231 232-505
  8. 2009050Domain d3qt0a_: 3qt0 A: [191953]
    automated match to d1fm9d_
    complexed with 486

Details for d3qt0a_

PDB Entry: 3qt0 (more details), 2.5 Å

PDB Description: Revealing a steroid receptor ligand as a unique PPARgamma agonist
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3qt0a_:

Sequence, based on SEQRES records: (download)

>d3qt0a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d3qt0a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkikfkhitpl
qeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytml
aslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiav
iilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehv
qllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d3qt0a_:

Click to download the PDB-style file with coordinates for d3qt0a_.
(The format of our PDB-style files is described here.)

Timeline for d3qt0a_: