Lineage for d3qp0b_ (3qp0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799342Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (21 PDB entries)
  8. 2799350Domain d3qp0b_: 3qp0 B: [191945]
    automated match to d1mrwa_
    complexed with cl, ni8; mutant

Details for d3qp0b_

PDB Entry: 3qp0 (more details), 1.45 Å

PDB Description: HIV-1 protease (mutant Q7K L33I L63I) in complex with a novel inhibitor
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3qp0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qp0b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3qp0b_:

Click to download the PDB-style file with coordinates for d3qp0b_.
(The format of our PDB-style files is described here.)

Timeline for d3qp0b_: