SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3q9mc_ (3q9m C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2052342Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2052343Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 protein domains)
    barrel, closed; n=5, S=8
  6. 2052432Protein automated matches [191079] (4 species)
    not a true protein
  7. 2052445Species Thermococcus thioreducens [TaxId:277988] [189009] (9 PDB entries)
  8. 2052457Domain d3q9mc_: 3q9m C: [191937]
    automated match to d3q5va_
    complexed with ca, mrd, ppv

Details for d3q9mc_

PDB Entry: 3q9m (more details), 1.34 Å

PDB Description: The structure archaeal inorganic pyrophosphatase in complex with pyrophosphate
PDB Compounds: (C:) Tt-IPPase

SCOPe Domain Sequences for d3q9mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9mc_ b.40.5.1 (C:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgk

SCOPe Domain Coordinates for d3q9mc_:

Click to download the PDB-style file with coordinates for d3q9mc_.
(The format of our PDB-style files is described here.)

Timeline for d3q9mc_: