Lineage for d3q82b_ (3q82 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244965Protein automated matches [190161] (23 species)
    not a true protein
  7. 2245193Species Staphylococcus aureus [TaxId:1280] [189852] (8 PDB entries)
  8. 2245203Domain d3q82b_: 3q82 B: [191936]
    automated match to d3q7va_
    complexed with gol, mer

Details for d3q82b_

PDB Entry: 3q82 (more details), 2.1 Å

PDB Description: Meropenem acylated BlaR1 sensor domain from Staphylococcus aureus
PDB Compounds: (B:) Beta-lactamase regulatory protein BlaR1

SCOPe Domain Sequences for d3q82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q82b_ e.3.1.1 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
sekilkemgvln

SCOPe Domain Coordinates for d3q82b_:

Click to download the PDB-style file with coordinates for d3q82b_.
(The format of our PDB-style files is described here.)

Timeline for d3q82b_: