Lineage for d3q3lf_ (3q3l F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790735Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2790843Protein automated matches [191079] (5 species)
    not a true protein
  7. 2790870Species Thermococcus thioreducens [TaxId:277988] [189009] (8 PDB entries)
  8. 2790900Domain d3q3lf_: 3q3l F: [191933]
    automated match to d3q5va_
    complexed with ca, dod

Details for d3q3lf_

PDB Entry: 3q3l (more details), 2.5 Å

PDB Description: the neutron crystallographic structure of inorganic pyrophosphatase from thermococcus thioreducens
PDB Compounds: (F:) Tt-IPPase

SCOPe Domain Sequences for d3q3lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3lf_ b.40.5.1 (F:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

SCOPe Domain Coordinates for d3q3lf_:

Click to download the PDB-style file with coordinates for d3q3lf_.
(The format of our PDB-style files is described here.)

Timeline for d3q3lf_: