SCOPe 2.06: Domain d3q3lb_: 3q3l B:

Lineage for d3q3lb_ (3q3l B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
   barrel, closed; n=5, S=8

6. Protein automated matches [191079] (4 species)
   not a true protein

7. Species Thermococcus thioreducens [TaxId:277988] [189009] (11 PDB entries)

8. Domain d3q3lb_: 3q3l B: [191929]
   automated match to d3q5va_
   complexed with ca, dod

Details for d3q3lb_

PDB Entry: 3q3l, 2.5 Å

PDB Description: the neutron crystallographic structure of inorganic pyrophosphatase from thermococcus thioreducens

PDB Compounds: (B:) Tt-IPPase

SCOPe Domain Sequences for d3q3lb_:

Sequence; same for both SEQRES and ATOM records:

>d3q3lb_ b.40.5.1 (B:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

Timeline for d3q3lb_:

• d3q3lb_ first appeared in SCOPe 2.02
  
• d3q3lb_ appears in SCOPe 2.05
  
• d3q3lb_ appears in SCOPe 2.07
  
• d3q3lb_ appears in the current release, SCOPe 2.08