Lineage for d3oevy_ (3oev Y:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1935363Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1935372Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935879Domain d3oevy_: 3oev Y: [191914]
    Other proteins in same PDB: d3oevb_, d3oevd_, d3oevf_, d3oevp_, d3oevr_, d3oevt_
    automated match to d1g0uk_
    complexed with 3oe, mes, mg

Details for d3oevy_

PDB Entry: 3oev (more details), 2.85 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 25
PDB Compounds: (Y:) Proteasome component PRE2

SCOPe Domain Sequences for d3oevy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oevy_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d3oevy_:

Click to download the PDB-style file with coordinates for d3oevy_.
(The format of our PDB-style files is described here.)

Timeline for d3oevy_: