Class b: All beta proteins [48724] (178 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries) |
Domain d3o9bb_: 3o9b B: [191907] automated match to d2f3ka_ complexed with act, gol, k2a, po4 |
PDB Entry: 3o9b (more details), 1.5 Å
SCOPe Domain Sequences for d3o9bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9bb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3o9bb_: