SCOPe 2.02: Domain d3o2xd_: 3o2x D:

Lineage for d3o2xd_ (3o2x D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Collagenase-3 (MMP-13) [55540] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55541] (28 PDB entries)

8. Domain d3o2xd_: 3o2x D: [191905]
   automated match to d3ljzd_
   complexed with 3o2, ca, epe, so4, zn

Details for d3o2xd_

PDB Entry: 3o2x, 1.9 Å

PDB Description: MMP-13 in complex with selective tetrazole core inhibitor

PDB Compounds: (D:) collagenase 3

SCOPe Domain Sequences for d3o2xd_:

Sequence; same for both SEQRES and ATOM records:

>d3o2xd_ d.92.1.11 (D:) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]}
anvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadi
misfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaahe
fghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslyg

Timeline for d3o2xd_:

• d3o2xd_ is new in SCOPe 2.02-stable
  
• d3o2xd_ appears in SCOPe 2.03
  
• d3o2xd_ appears in the current release, SCOPe 2.08, called d3o2xd1