Lineage for d1ft2a_ (1ft2 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) 
Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins) Protein Protein farnesyltransferase alpha-subunit [48441] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (6 PDB entries) 
Domain d1ft2a_: 1ft2 A: [19190]
Other proteins in same PDB: d1ft2b_
Details for d1ft2a_
PDB Entry: 1ft2 (more details), 3.4 Å
PDB Description: co-crystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate
SCOP Domain Sequences for d1ft2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft2a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsr
SCOP Domain Coordinates for d1ft2a_:
Click to download the PDB-style file with coordinates for d1ft2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ft2a_:
- d1ft2a_ appears in SCOP 1.57
- d1ft2a_ appears in the current release, SCOPe 2.08
View in 3D
