Lineage for d1fppa_ (1fpp A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922275Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 922276Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 922277Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 922324Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (29 PDB entries)
    Uniprot Q04631 55-369
  8. 922373Domain d1fppa_: 1fpp A: [19189]
    Other proteins in same PDB: d1fppb_
    complexed with fpp, po4, zn

Details for d1fppa_

PDB Entry: 1fpp (more details), 2.75 Å

PDB Description: protein farnesyltransferase complex with farnesyl diphosphate
PDB Compounds: (A:) protein farnesyltransferase

SCOPe Domain Sequences for d1fppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fppa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsre

SCOPe Domain Coordinates for d1fppa_:

Click to download the PDB-style file with coordinates for d1fppa_.
(The format of our PDB-style files is described here.)

Timeline for d1fppa_: