Lineage for d1fppa_ (1fpp A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 217174Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 217175Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 217176Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 217181Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (14 PDB entries)
  8. 217191Domain d1fppa_: 1fpp A: [19189]
    Other proteins in same PDB: d1fppb_
    complexed with fpp, po4, zn

Details for d1fppa_

PDB Entry: 1fpp (more details), 2.75 Å

PDB Description: protein farnesyltransferase complex with farnesyl diphosphate

SCOP Domain Sequences for d1fppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fppa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsre

SCOP Domain Coordinates for d1fppa_:

Click to download the PDB-style file with coordinates for d1fppa_.
(The format of our PDB-style files is described here.)

Timeline for d1fppa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fppb_