SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1fppa_ (1fpp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007074Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2007075Family a.118.6.1: Protein prenylyltransferase [48440] (3 protein domains)
  6. 2007076Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2007091Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2007187Domain d1fppa_: 1fpp A: [19189]
    Other proteins in same PDB: d1fppb_
    complexed with fpp, po4, zn

Details for d1fppa_

PDB Entry: 1fpp (more details), 2.75 Å

PDB Description: protein farnesyltransferase complex with farnesyl diphosphate
PDB Compounds: (A:) protein farnesyltransferase

SCOPe Domain Sequences for d1fppa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fppa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsre

SCOPe Domain Coordinates for d1fppa_:

Click to download the PDB-style file with coordinates for d1fppa_.
(The format of our PDB-style files is described here.)

Timeline for d1fppa_: