Lineage for d3ihca_ (3ihc A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955272Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 1955321Species Mouse (Mus musculus) [TaxId:10090] [103423] (9 PDB entries)
  8. 1955325Domain d3ihca_: 3ihc A: [191884]
    automated match to d1pq1a_

Details for d3ihca_

PDB Entry: 3ihc (more details), 1.85 Å

PDB Description: Crystal structure of mouse Bcl-xl (wt) at pH 5.0
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3ihca_:

Sequence, based on SEQRES records: (download)

>d3ihca_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Mouse (Mus musculus) [TaxId: 10090]}
sqsnrelvvdflsyklsqkgyswsqfsdveenrteapeeteaeretpsaingnpswhlad
spavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtayq
sfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmatylndhlepw
iqenggwdtfvdlyg

Sequence, based on observed residues (ATOM records): (download)

>d3ihca_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Mouse (Mus musculus) [TaxId: 10090]}
sqsnrelvvdflsyklsqkgyswsqfpmaavkqalreagdefelryrrafsdltsqlhit
pgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmatyln
dhlepwiqenggwdtfvdlyg

SCOPe Domain Coordinates for d3ihca_:

Click to download the PDB-style file with coordinates for d3ihca_.
(The format of our PDB-style files is described here.)

Timeline for d3ihca_: