Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Coagulation factor Xa, protease domain [50574] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50575] (46 PDB entries) Uniprot P00742 235-467 |
Domain d3hptd_: 3hpt D: [191883] automated match to d1c5md_ complexed with act, ca, dms, gol, mes, na, yet |
PDB Entry: 3hpt (more details), 2.19 Å
SCOPe Domain Sequences for d3hptd_:
Sequence, based on SEQRES records: (download)
>d3hptd_ b.47.1.2 (D:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktrglp
>d3hptd_ b.47.1.2 (D:) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthegrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqedac qgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktrglp
Timeline for d3hptd_: