Lineage for d3fxsa_ (3fxs A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1423507Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 1423520Protein Thermolysin [63414] (1 species)
  7. 1423521Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (121 PDB entries)
    Uniprot P00800
  8. 1423556Domain d3fxsa_: 3fxs A: [191882]
    automated match to d1kkka_
    complexed with ca, gol, ru

Details for d3fxsa_

PDB Entry: 3fxs (more details), 1.55 Å

PDB Description: metal exchange in thermolysin
PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d3fxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fxsa_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d3fxsa_:

Click to download the PDB-style file with coordinates for d3fxsa_.
(The format of our PDB-style files is described here.)

Timeline for d3fxsa_: