SCOPe 2.05: Domain d3f5vb_: 3f5v B:

Lineage for d3f5vb_ (3f5v B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Major mite fecal allergen der p 1 [142848] (1 species)

7. Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [142849] (3 PDB entries)
   Uniprot P08176 19-320! Uniprot P08176 99-320

8. Domain d3f5vb_: 3f5v B: [191872]
   automated match to d2as8a1
   complexed with ca, p6g

Details for d3f5vb_

PDB Entry: 3f5v, 1.36 Å

PDB Description: c2 crystal form of mite allergen der p 1

PDB Compounds: (B:) Der p 1 allergen

SCOPe Domain Sequences for d3f5vb_:

Sequence; same for both SEQRES and ATOM records:

>d3f5vb_ d.3.1.1 (B:) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq
elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy
ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna
qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil

Timeline for d3f5vb_:

• d3f5vb_ first appeared in SCOPe 2.02
  
• d3f5vb_ appears in SCOPe 2.04
  
• d3f5vb_ appears in SCOPe 2.06
  
• d3f5vb_ appears in the current release, SCOPe 2.08