Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Major mite fecal allergen der p 1 [142848] (1 species) |
Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [142849] (3 PDB entries) Uniprot P08176 19-320! Uniprot P08176 99-320 |
Domain d3f5vb_: 3f5v B: [191872] automated match to d2as8a1 complexed with ca, p6g |
PDB Entry: 3f5v (more details), 1.36 Å
SCOPe Domain Sequences for d3f5vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f5vb_ d.3.1.1 (B:) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil
Timeline for d3f5vb_: