SCOP 1.73: Domain d1qbqa_: 1qbq A:

Lineage for d1qbqa_ (1qbq A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family)

5. Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)

6. Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (27 PDB entries)

8. Domain d1qbqa_: 1qbq A: [19187]
   Other proteins in same PDB: d1qbqb_
   complexed with ace, act, hfp, zn

Details for d1qbqa_

PDB Entry: 1qbq, 2.4 Å

PDB Description: structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.

PDB Compounds: (A:) fpt alpha-subunit

SCOP Domain Sequences for d1qbqa_:

Sequence; same for both SEQRES and ATOM records:

>d1qbqa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqsk

Timeline for d1qbqa_:

• d1qbqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qbqa_ appears in SCOP 1.71
  
• d1qbqa_ appears in SCOP 1.75
  
• d1qbqa_ appears in the current release, SCOPe 2.08