SCOPe 2.05: Domain d3b2fb_: 3b2f B:

Lineage for d3b2fb_ (3b2f B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Maize (Zea mays) [TaxId:4577] [54305] (3 PDB entries)

8. Domain d3b2fb_: 3b2f B: [191861]
   automated match to d1gaqb_
   complexed with fes

Details for d3b2fb_

PDB Entry: 3b2f, 1.7 Å

PDB Description: Maize Ferredoxin 1

PDB Compounds: (B:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d3b2fb_:

Sequence; same for both SEQRES and ATOM records:

>d3b2fb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeelt

Timeline for d3b2fb_:

• d3b2fb_ first appeared in SCOPe 2.02
  
• d3b2fb_ appears in SCOPe 2.04
  
• d3b2fb_ appears in SCOPe 2.06
  
• d3b2fb_ appears in the current release, SCOPe 2.08