Lineage for d3b2fb_ (3b2f B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933818Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries)
  8. 2933820Domain d3b2fb_: 3b2f B: [191861]
    automated match to d1gaqb_
    complexed with fes

Details for d3b2fb_

PDB Entry: 3b2f (more details), 1.7 Å

PDB Description: Maize Ferredoxin 1
PDB Compounds: (B:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d3b2fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2fb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
qsylddgqiadgwvltchayptsdvviethkeeelt

SCOPe Domain Coordinates for d3b2fb_:

Click to download the PDB-style file with coordinates for d3b2fb_.
(The format of our PDB-style files is described here.)

Timeline for d3b2fb_: