![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
![]() | Protein 2Fe-2S ferredoxin [54294] (19 species) |
![]() | Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries) |
![]() | Domain d3b2fb_: 3b2f B: [191861] automated match to d1gaqb_ complexed with fes |
PDB Entry: 3b2f (more details), 1.7 Å
SCOPe Domain Sequences for d3b2fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b2fb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]} atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd qsylddgqiadgwvltchayptsdvviethkeeelt
Timeline for d3b2fb_: