Lineage for d3atia_ (3ati A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065466Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
    Uniprot P00760
  8. 2065704Domain d3atia_: 3ati A: [191854]
    automated match to d1utna_
    complexed with ca, dms, sz4

Details for d3atia_

PDB Entry: 3ati (more details), 1.71 Å

PDB Description: Crystal structure of trypsin complexed with (3-methoxyphenyl)methanamine
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3atia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atia_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3atia_:

Click to download the PDB-style file with coordinates for d3atia_.
(The format of our PDB-style files is described here.)

Timeline for d3atia_: