Lineage for d1d8da_ (1d8d A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339381Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2339382Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2339383Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2339398Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2339399Domain d1d8da_: 1d8d A: [19185]
    Other proteins in same PDB: d1d8db_
    complex with K-ras4b peptide substrate
    complexed with act, fii, zn

Details for d1d8da_

PDB Entry: 1d8d (more details), 2 Å

PDB Description: co-crystal structure of rat protein farnesyltransferase complexed with a k-ras4b peptide substrate and fpp analog at 2.0a resolution
PDB Compounds: (A:) farnesyltransferase (alpha subunit)

SCOPe Domain Sequences for d1d8da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8da_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsresdipasv

SCOPe Domain Coordinates for d1d8da_:

Click to download the PDB-style file with coordinates for d1d8da_.
(The format of our PDB-style files is described here.)

Timeline for d1d8da_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d8db_