Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (3 families) |
Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein) membrane-anchored rubredoxin-like domain |
Protein Cytochrome c oxidase Subunit F [57819] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [57820] (23 PDB entries) |
Domain d3asof_: 3aso F: [191849] Other proteins in same PDB: d3asoc_, d3asog_, d3ason_, d3asop_, d3asoq_, d3asor_, d3asot_, d3asou_, d3asov_, d3asow_, d3asox_, d3asoy_, d3asoz_ automated match to d1v54f_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3aso (more details), 2.3 Å
SCOPe Domain Sequences for d3asof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3asof_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]} asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc iceednstviwfwlhkgeaqrcpscgthyklvphqlah
Timeline for d3asof_: