Lineage for d3an4b_ (3an4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (111 PDB entries)
    Uniprot P37231 232-505
  8. 2009014Domain d3an4b_: 3an4 B: [191847]
    automated match to d3ty0a_
    complexed with m7r

Details for d3an4b_

PDB Entry: 3an4 (more details), 2.3 Å

PDB Description: Human PPAR gamma ligand binding domain in complex with a gamma selective agonist MO4R
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3an4b_:

Sequence, based on SEQRES records: (download)

>d3an4b_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiy

Sequence, based on observed residues (ATOM records): (download)

>d3an4b_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgktspfviydmnslmmgedkikfkhke
vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
kktetdmslhpllqeiy

SCOPe Domain Coordinates for d3an4b_:

Click to download the PDB-style file with coordinates for d3an4b_.
(The format of our PDB-style files is described here.)

Timeline for d3an4b_: