Lineage for d1slya1 (1sly A:1-450)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007067Superfamily a.118.5: Bacterial muramidases [48435] (1 family) (S)
  5. 2007068Family a.118.5.1: Bacterial muramidases [48436] (1 protein)
  6. 2007069Protein 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain [48437] (1 species)
  7. 2007070Species Escherichia coli [TaxId:562] [48438] (3 PDB entries)
  8. 2007073Domain d1slya1: 1sly A:1-450 [19184]
    Other proteins in same PDB: d1slya2
    complexed with blg

Details for d1slya1

PDB Entry: 1sly (more details), 2.8 Å

PDB Description: complex of the 70-kda soluble lytic transglycosylase with bulgecin a
PDB Compounds: (A:) 70-kda soluble lytic transglycosylase

SCOPe Domain Sequences for d1slya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slya1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}
dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
ryafnnqwwdlsvqatiagklwdhleerfp

SCOPe Domain Coordinates for d1slya1:

Click to download the PDB-style file with coordinates for d1slya1.
(The format of our PDB-style files is described here.)

Timeline for d1slya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slya2