SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1slya1 (1sly A:1-450)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007067Superfamily a.118.5: Bacterial muramidases [48435] (1 family) (S)
  5. 2007068Family a.118.5.1: Bacterial muramidases [48436] (1 protein)
  6. 2007069Protein 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain [48437] (1 species)
  7. 2007070Species Escherichia coli [TaxId:562] [48438] (3 PDB entries)
  8. 2007073Domain d1slya1: 1sly A:1-450 [19184]
    Other proteins in same PDB: d1slya2
    complexed with blg

Details for d1slya1

PDB Entry: 1sly (more details), 2.8 Å

PDB Description: complex of the 70-kda soluble lytic transglycosylase with bulgecin a
PDB Compounds: (A:) 70-kda soluble lytic transglycosylase

SCOPe Domain Sequences for d1slya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slya1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}
dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
ryafnnqwwdlsvqatiagklwdhleerfp

SCOPe Domain Coordinates for d1slya1:

Click to download the PDB-style file with coordinates for d1slya1.
(The format of our PDB-style files is described here.)

Timeline for d1slya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1slya2